PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6AL_BB730675A.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 253aa    MW: 27819 Da    PI: 6.2456
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6AL_BB730675A.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.51.2e-161461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           rg+WT+eEd  lv  ++q+G  +W++ ++  g+ R++k+c++rw +yl
  Traes_6AL_BB730675A.1 14 RGPWTAEEDMTLVAHIEQHGHSNWRALPKQAGLLRCGKSCRLRWINYL 61
                           89******************************99************97 PP

2Myb_DNA-binding54.92e-1767112148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            rg++T eE++ +++++++lG++ W+tIa++++ gRt++++k+ w+++l
  Traes_6AL_BB730675A.1  67 RGNFTSEEEDAIIQLHAMLGNR-WSTIAARLP-GRTDNEIKNVWNTHL 112
                            89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-24564IPR009057Homeodomain-like
PROSITE profilePS5129413.125961IPR017930Myb domain
SuperFamilySSF466891.39E-3011108IPR009057Homeodomain-like
SMARTSM007174.5E-131363IPR001005SANT/Myb domain
PfamPF002491.8E-141461IPR001005SANT/Myb domain
CDDcd001677.50E-111661No hitNo description
PROSITE profilePS5129425.73962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.1E-2765116IPR009057Homeodomain-like
SMARTSM007176.6E-1566114IPR001005SANT/Myb domain
PfamPF002491.2E-1567112IPR001005SANT/Myb domain
CDDcd001672.93E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MVRAPCCEQT GIKRGPWTAE EDMTLVAHIE QHGHSNWRAL PKQAGLLRCG KSCRLRWINY  60
LRPDIKRGNF TSEEEDAIIQ LHAMLGNRWS TIAARLPGRT DNEIKNVWNT HLKKRLDSSS  120
SKTSGQAAPK RKAKKPAVVA SALEGPTSKP ASSPGHSLSM SPEQSLSTSS ATDYSMTSSL  180
ENTGSSSSWE EFQIDDSFWS ETLGMSVDSS SFGMETCDTF SVDSASPSSS NDEMDFWVTL  240
FMQAGDMQSL SQI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-28141187110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9690510.0JN969051.1 Triticum aestivum MYB73 (MYB73) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575391.11e-131PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH44e-94MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLW5G9U40.0W5G9U4_WHEAT; Uncharacterized protein
STRINGMLOC_34646.11e-154(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.16e-72myb domain protein 15
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]